PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA02g15540
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family HD-ZIP
Protein Properties Length: 179aa    MW: 20604.2 Da    PI: 8.3421
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA02g15540genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.91.9e-191670256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
    Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                +++ ++t++q++ Le  F +n++++ +++ +LA++lgL+ rqV +W+qN+Ra++k
  CA02g15540 16 CHKKRLTQDQVRLLEISFSSNNKLDSDRKSQLAQELGLPPRQVAIWYQNKRARWK 70
                567789************************************************9 PP

2HD-ZIP_I/II113.81.1e-3617108293
  HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  +k+rl+++qv+lLE sF++++kL+++rK++la+eLgl prqva+W+qn+RAR+kt+ lE+dy++L++++d+  e+ne+L+ eve+Lr+el++
   CA02g15540  17 HKKRLTQDQVRLLEISFSSNNKLDSDRKSQLAQELGLPPRQVAIWYQNKRARWKTQSLEVDYKTLQQRLDTALEDNEKLKLEVERLRKELNK 108
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.1151272IPR001356Homeobox domain
SMARTSM003892.7E-171576IPR001356Homeobox domain
SuperFamilySSF466896.84E-181681IPR009057Homeodomain-like
CDDcd000867.20E-151773No hitNo description
PfamPF000461.3E-161770IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-191979IPR009057Homeodomain-like
PRINTSPR000315.9E-64352IPR000047Helix-turn-helix motif
PROSITE patternPS0002704770IPR017970Homeobox, conserved site
PRINTSPR000315.9E-65268IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009637Biological Processresponse to blue light
GO:0009646Biological Processresponse to absence of light
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MDFLNVQSTR KSHLKCHKKR LTQDQVRLLE ISFSSNNKLD SDRKSQLAQE LGLPPRQVAI  60
WYQNKRARWK TQSLEVDYKT LQQRLDTALE DNEKLKLEVE RLRKELNKTQ EMLLGFNTPT  120
NYSSISSSCD EVGSTSCLQL HDQSKHNHLD KEFFACLIGD EGHFGTPNGH NFFTSSMS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1919RKSHLKCHKKR
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754411e-164HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016567874.11e-131PREDICTED: homeobox-leucine zipper protein ATHB-52-like
TrEMBLM1D4I81e-113M1D4I8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000812961e-112(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27152453
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.12e-27homeobox protein 52